General Information

  • ID:  hor002406
  • Uniprot ID:  A0MLS4
  • Protein name:  Ghrelin
  • Gene name:  GHRL
  • Organism:  Papio hamadryas (Hamadryas baboon)
  • Family:  Motilin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Papio (genus), Cercopithecinae (subfamily), Cercopithecidae (family), Cercopithecoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0016608 growth hormone-releasing hormone activity; GO:0030296 protein tyrosine kinase activator activity; GO:0031768 ghrelin receptor binding
  • GO BP:  GO:0001937 negative regulation of endothelial cell proliferation; GO:0007165 signal transduction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0008154 actin polymerization or depolymerization; GO:0009725 response to hormone; GO:0016358 dendrite development; GO:0032024 positive regulation of insulin secretion; GO:0032095 regulation of response to food; GO:0032097 positive regulation of response to food; GO:0032691 negative regulation of interleukin-1 beta production; GO:0032715 negative regulation of interleukin-6 production; GO:0032720 negative regulation of tumor necrosis factor production; GO:0042127 regulation of cell population proliferation; GO:0043066 negative regulation of apoptotic process; GO:0043410 positive regulation of MAPK cascade
  • GO CC:  NA

Sequence Information

  • Sequence:  GSSFLSPEHQRAQQRKESKKPPAKLQPR
  • Length:  28
  • Propeptide:  MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRAQQRKESKKPPAKLQPRALGGWLRPEDGDQAEGAEDELEIQFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
  • Signal peptide:  MPSPGTVCSLLLLGMLWLDLAMA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0MLS4-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002406_AF2.pdbhor002406_ESM.pdb

Physical Information

Mass: 369840 Formula: C139H231N47O41
Absent amino acids: CDIMNTVWY Common amino acids: KPQS
pI: 11.72 Basic residues: 8
Polar residues: 5 Hydrophobic residues: 5
Hydrophobicity: -176.07 Boman Index: -10362
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 35
Instability Index: 7334.64 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA